PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010912590.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 199aa    MW: 22759.6 Da    PI: 5.5723
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010912590.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM122.53.7e-3881251128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGf+F P+d+elvv++L++k+++ +++  ++i+++d+ +++PwdL+ k+ ++ k wyfF++r         +nr t++gyWk t  +++++s 
  XP_010912590.1   8 LPPGFHFFPSDQELVVHFLHRKAARLPCQP-DIIPTIDLRYCDPWDLNGKAFQGGKYWYFFTHRV--------QNRETANGYWKPTDMEESITS- 92 
                     79*************************999.99**************976667899******985........58999****************. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                     ++ +vglk+tL+fy g+ p+g kt+Wvmhey+l
  XP_010912590.1  93 GDIDVGLKRTLIFYVGEPPEGMKTNWVMHEYHL 125
                     999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.53E-485164IPR003441NAC domain
PROSITE profilePS5100542.9848165IPR003441NAC domain
PfamPF023656.4E-249125IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MGEGTTNLPP GFHFFPSDQE LVVHFLHRKA ARLPCQPDII PTIDLRYCDP WDLNGKAFQG  60
GKYWYFFTHR VQNRETANGY WKPTDMEESI TSGDIDVGLK RTLIFYVGEP PEGMKTNWVM  120
HEYHLLDGVL SSASSSGGSS RRSLKKRSNT RMEPNKWIIC RVYESSCASQ NFHDDGLELS  180
CLDEVFLSFD DLDEVSLPK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-38717116171NO APICAL MERISTEM PROTEIN
1ut4_B5e-38717116171NO APICAL MERISTEM PROTEIN
1ut7_A5e-38717116171NO APICAL MERISTEM PROTEIN
1ut7_B5e-38717116171NO APICAL MERISTEM PROTEIN
3swm_A5e-38717119174NAC domain-containing protein 19
3swm_B5e-38717119174NAC domain-containing protein 19
3swm_C5e-38717119174NAC domain-containing protein 19
3swm_D5e-38717119174NAC domain-containing protein 19
3swp_A5e-38717119174NAC domain-containing protein 19
3swp_B5e-38717119174NAC domain-containing protein 19
3swp_C5e-38717119174NAC domain-containing protein 19
3swp_D5e-38717119174NAC domain-containing protein 19
4dul_A5e-38717116171NAC domain-containing protein 19
4dul_B5e-38717116171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010912590.11e-150PREDICTED: NAC transcription factor 29-like
SwissprotQ8GWK63e-64NC104_ARATH; NAC domain-containing protein 104
TrEMBLA0A0A9FYS56e-87A0A0A9FYS5_ARUDO; Uncharacterized protein
STRINGGSMUA_Achr6P17670_0012e-86(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36673679
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64530.17e-64xylem NAC domain 1